Structure of PDB 1yn4 Chain A |
>1yn4A (length=99) Species: 1280 (Staphylococcus aureus) [Search protein sequence] |
GKHTVPYTISVDGITALHRTYFVFPENKKVLYQEIDSKVKNELASQRGVT TEKINNAQTATYTLTLNDGNKKVVNLKKNDDAKNSIDPSTIKQIQIVVK |
|
PDB | 1yn4 The Crystal Structures of EAP Domains from Staphylococcus aureus Reveal an Unexpected Homology to Bacterial Superantigens. |
Chain | A |
Resolution | 1.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
H45 E68 |
H3 E26 |
|
|
|
|