Structure of PDB 1yjv Chain A |
>1yjvA (length=75) Species: 9606 (Homo sapiens) [Search protein sequence] |
MGDGVLELVVRGMTCASCVHKIESSLTKHRGILYCSVALATNKAHIKYDP EIIGPRDIIHTIESLGFEASLVKIE |
|
PDB | 1yjv An atomic-level investigation of the disease-causing A629P mutant of the Menkes protein, ATP7A |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
7.2.2.8: P-type Cu(+) transporter. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU1 |
A |
C15 C18 |
C15 C18 |
|
|
|
|