Structure of PDB 1yd2 Chain A |
>1yd2A (length=90) Species: 2336 (Thermotoga maritima) [Search protein sequence] |
MKEKIRKKILLAPEEPGVFIFKNKGVPIYIGKAKRLSNRLRSYLNPQTEK VFRIGEEADELETIVVMNEREAFILEANLIKKYRPKYNVR |
|
PDB | 1yd2 Structural insights into the first incision reaction during nucleotide excision repair |
Chain | A |
Resolution | 1.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MN |
A |
K4 E60 L61 |
K4 E60 L61 |
|
|
|
|