Structure of PDB 1y6g Chain A

Receptor sequence

>1y6gA (length=392) Species: 10665 (Tequatrovirus T4)

MGSMRICIFMARGLEGCGVTKFSLEQRDWFIKNGHEVTLVYAKDKSFTRT
SSHDHKSFSIPVILAKEYDKALKLVNDCDILIINSVPATSVQEATINNYK
KLLDNIKPSIRVVVYQHDHSVLSLRRNLGLEETVRRADVIFSHSDNGDFN
KVLMKEWYPAPTVYNFQPPMDIVKVRSTYWKDVSEINMNINRWIGRTTTW
KGFYQMFDFHEKFLKPAGKSTVMEGLERSPAFIAIKEKGIPYEYYGNREI
DKMNLAPNQPAQILDCYINSEMLERMSKSGFGYQLSKLNQKYLQRSLEYT
HLELGACGTIPVFWKSTGENLKFRVDNTPLTSHDSGIIWFDENDMESTFE
RIKELSSDRALYDREREKAYEFLYQHQDSSFCFKEQFDIITK

3D structure

• PDB: 1y6g Structural evidence of a passive base-flipping mechanism for AGT, an unusual GT-B glycosyltransferase.
• Chain: A
• Resolution: 2.8 Å

Enzymatic activity

• Enzyme Commision number: 2.4.1.26: DNA alpha-glucosyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	T1206 T1207 W1208 E1235 R1236 S1237 A1239	T198 T199 W200 E227 R228 S229 A231
BS02	dna	A	R1236 P1238 I1241 K1244	R228 P230 I233 K236
BS03	UDP	A	C1014 G1015 R1046 S1049 H1050 R1204 K1209 Y1275 N1277 E1306 Y1307 T1308 E1311	C17 G18 R49 S52 H53 R196 K201 Y267 N269 E298 Y299 T300 E303

Gene Ontology

Molecular Function

• GO:0016757 glycosyltransferase activity
• GO:0033820 DNA alpha-glucosyltransferase activity

Biological Process

• GO:0006304 DNA modification
• GO:0019049 virus-mediated perturbation of host defense response
• GO:0039504 symbiont-mediated suppression of host adaptive immune response
• GO:0098672 symbiont-mediated suppression of host CRISPR-cas system
• GO:0099018 symbiont-mediated evasion of host restriction-modification system

External links

• PDB: RCSB:1y6g, PDBe:1y6g, PDBj:1y6g
• PDBsum: 1y6g
• PubMed: 16081100
• UniProt: P04519|GSTA_BPT4 DNA alpha-glucosyltransferase (Gene Name=agt)