Structure of PDB 1y63 Chain A

Receptor sequence

>1y63A (length=168) Species: 347515 (Leishmania major strain Friedlin)

EQPKGINILITGTPGTGKTSMAEMIAAELDGFQHLEVGKLVKENHFYTET
HIIEEKDEDRLLDFMEPIMVSRGNHVVDYHSSELFPERWFHMVVVLHTST
EVLFERLTKRQYSEAKRAENMEAEIQCICEEEARDAYEDDIVLVRENDTL
EQMAATVEEIRERVEVLK

3D structure

• PDB: 1y63 Crystal structural analysis of a probable kinase from Leishmania major Friedlin
• Chain: A
• Resolution: 1.7 Å

Enzymatic activity

• Enzyme Commision number: 2.7.4.3: adenylate kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	A	E28 H39	E23 H34
BS02	MN	A	E98 A147	E87 A136
BS03	MN	A	S82 R83 H86	S71 R72 H75
BS04	MN	A	Y123 N131	Y112 N120
BS05	MN	A	Y90 H91	Y79 H80
BS06	ADP	A	G20 G22 K23 T24 S25 R117 N158 D159 T160 M164	G15 G17 K18 T19 S20 R106 N147 D148 T149 M153

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0004017 adenylate kinase activity
• GO:0005524 ATP binding
• GO:0016301 kinase activity
• GO:0016887 ATP hydrolysis activity
• GO:0042134 rRNA primary transcript binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006364 rRNA processing
• GO:0006979 response to oxidative stress
• GO:0009267 cellular response to starvation
• GO:0016310 phosphorylation
• GO:0030490 maturation of SSU-rRNA
• GO:0042254 ribosome biogenesis
• GO:0042274 ribosomal small subunit biogenesis
• GO:0046940 nucleoside monophosphate phosphorylation

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005929 cilium
• GO:0010494 cytoplasmic stress granule
• GO:0031981 nuclear lumen

External links

• PDB: RCSB:1y63, PDBe:1y63, PDBj:1y63
• PDBsum: 1y63
• UniProt: Q4Q7A6