Structure of PDB 1xts Chain A

Receptor sequence

>1xtsA (length=171) Species: 9606 (Homo sapiens) [Search protein sequence]

PQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNG
QEYHLQLVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHG
KLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAK
ENQTAVDVFRRIILEAEKLEH

3D structure

PDB

1xts Structural Basis for the Unique Biological Function of Small GTPase RHEB

Chain

Resolution

2.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.6.5.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	A	S20 T38	S19 T37
BS02	GTP	A	R15 S16 V17 G18 K19 S20 S21 F31 Y35 T38 G63 K120 D122 L123 S149 A150	R14 S15 V16 G17 K18 S19 S20 F30 Y34 T37 G62 K119 D121 L122 S148 A149

Gene Ontology

	Molecular Function
GO:0000287	magnesium ion binding
GO:0003924	GTPase activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0016787	hydrolase activity
GO:0019003	GDP binding
GO:0019901	protein kinase binding
GO:0030295	protein kinase activator activity
GO:0043539	protein serine/threonine kinase activator activity
GO:0046872	metal ion binding

	Biological Process
GO:0007165	signal transduction
GO:0007264	small GTPase-mediated signal transduction
GO:0016241	regulation of macroautophagy
GO:0031669	cellular response to nutrient levels
GO:0032006	regulation of TOR signaling
GO:0032008	positive regulation of TOR signaling
GO:0048709	oligodendrocyte differentiation
GO:0048714	positive regulation of oligodendrocyte differentiation
GO:0051726	regulation of cell cycle
GO:0120163	negative regulation of cold-induced thermogenesis
GO:1904263	positive regulation of TORC1 signaling
GO:2000074	regulation of type B pancreatic cell development

	Cellular Component
GO:0000139	Golgi membrane
GO:0005681	spliceosomal complex
GO:0005737	cytoplasm
GO:0005764	lysosome
GO:0005765	lysosomal membrane
GO:0005783	endoplasmic reticulum
GO:0005789	endoplasmic reticulum membrane
GO:0005794	Golgi apparatus
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0012505	endomembrane system
GO:0014069	postsynaptic density
GO:0016020	membrane
GO:0045202	synapse
GO:0070062	extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1xts, PDBe:1xts, PDBj:1xts
PDBsum	1xts
PubMed	15728574
UniProt	Q15382\|RHEB_HUMAN GTP-binding protein Rheb (Gene Name=RHEB)

[Back to BioLiP]