Structure of PDB 1xqd Chain A

Receptor sequence

>1xqdA (length=399) Species: 5507 (Fusarium oxysporum)

APSFPFSRASGPEPPAEFAKLRATNPVSQVKLFDGSLAWLVTKHKDVCFV
ATSEKLSKVRTRQGFPELGAGGKQAAKAKPTFVDMDPPEHMHQRSMVEPT
FTPEAVKNLQPYIQRTVDDLLEQMKQKGCANGPVDLVKEFALPVPSYIIY
TLLGVPFNDLEYLTQQNAIRTNGSSTARQASAANQELLDYLAILVEQRLV
EPKDDIISKLCTEQVKPGNIDKSDAVQIAFLLLVAGNATMVNMIALGVAT
LAQHPDQLAQLKANPSLAPQFVEELCRYHTASALAIKRTAKEDVMIGDKL
VRANEGIIASNQSANRDEEVFENPDEFNMNRKWPPQDPLGFGFGDHRCIA
EHLAKAELTTVFSTLYQKFPDLKVAVPLGKINYTPLNRDVGIVDLPVIF

3D structure

• PDB: 1xqd Structural evidence for direct hydride transfer from NADH to cytochrome P450nor
• Chain: A
• Resolution: 1.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): T175 A239 A242 T243 M244 S286 C352 I353 A354 E361 D393
• Catalytic site (residue number reindexed from 1): T171 A235 A238 T239 M240 S282 C348 I349 A350 E357 D389
• Enzyme Commision number: 1.7.1.14: nitric oxide reductase [NAD(P)(+), nitrous oxide-forming].

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	F86 V87 H94 R98 F105 A239 G240 T243 M244 A289 I290 R292 G344 F345 G346 H350 C352 I353 A354	F82 V83 H90 R94 F101 A235 G236 T239 M240 A285 I286 R288 G340 F341 G342 H346 C348 I349 A350
BS02	DND	A	R64 G75 G76 Q78 A79 R174 T175 A184 N188 A239 G240 T243 S286 A289	R60 G71 G72 Q74 A75 R170 T171 A180 N184 A235 G236 T239 S282 A285	MOAD: Kd=0.07mM

Gene Ontology

Molecular Function

• GO:0004497 monooxygenase activity
• GO:0005506 iron ion binding
• GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:0102199 nitric oxide reductase (NAD(P)H) activity

External links

• PDB: RCSB:1xqd, PDBe:1xqd, PDBj:1xqd
• PDBsum: 1xqd
• PubMed: 15313618
• UniProt: P23295|NOR_FUSOX NADP nitrous oxide-forming nitric oxide reductase (Gene Name=CYP55A1)