Structure of PDB 1xpa Chain A |
>1xpaA (length=113) Species: 9606 (Homo sapiens) [Search protein sequence] |
MEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQE YLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQ EALEEAKEVRQEN |
|
PDB | 1xpa Solution structure of the DNA- and RPA-binding domain of the human repair factor XPA. |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C105 C108 C129 |
C8 C11 C32 |
|
|
|
|