Structure of PDB 1xox Chain A |
>1xoxA (length=117) Species: 9606 (Homo sapiens) [Search protein sequence] |
MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTEN EPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGE FLKLDRERAKNKIAKET |
|
PDB | 1xox Solution structure of human survivin and its binding interface with smac/diablo |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C57 C60 H77 C84 |
C57 C60 H77 C84 |
|
|
|