Structure of PDB 1xmt Chain A

Receptor sequence

>1xmtA (length=95) Species: 3702 (Arabidopsis thaliana)

PPKIVWNEGKRRFETEDHEAFIEYKMRNNGKVMDLVHTYVPSFKRGLGLA
SHLCVAAFEHASSHSISIIPSCSYVSDTFLPRNPSWKPLIHSEVF

3D structure

• PDB: 1xmt Structure of Arabidopsis thaliana At1g77540 Protein, a Minimal Acetyltransferase from the COG2388 Family.
• Chain: A
• Resolution: 1.15 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BR	A	T19 K48	T15 K44
BS02	BR	A	M30 R31 N33 G34	M26 R27 N29 G30
BS03	BR	A	S55 Y78 F83	S51 Y74 F79
BS04	BR	A	V44 A54	V40 A50
BS05	BR	A	G50 G52	G46 G48
BS06	BR	A	R15 M30	R11 M26

External links

• PDB: RCSB:1xmt, PDBe:1xmt, PDBj:1xmt
• PDBsum: 1xmt
• PubMed: 17128971
• UniProt: Q9CAQ2|Y1754_ARATH Acetyltransferase At1g77540 (Gene Name=At1g77540)