Structure of PDB 1xki Chain A

Receptor sequence
>1xkiA (length=128) Species: 9606 (Homo sapiens) [Search protein sequence]
DVSGTWYLKAMTVNLESVTPMTLTTLEGGNLEAKVTMSGRCQEVKAVLEK
TDEPGKYTADGGKHVAYIIRSHVKDHYIFYSEGEGKPVRGVKLVGRDPKN
NLEALEDFEKAAGARGLSTESILIPRQS
3D structure
PDB1xki The 1.8-A crystal structure of human tear lipocalin reveals an extended branched cavity with capacity for multiple ligands
ChainA
Resolution1.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A E73 K76 E53 K56
BS02 ZN A H96 E125 H76 E103
BS03 ZN A H92 D129 H72 D107
Gene Ontology
Molecular Function
GO:0004869 cysteine-type endopeptidase inhibitor activity
GO:0005102 signaling receptor binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0031404 chloride ion binding
GO:0036094 small molecule binding
Biological Process
GO:0006508 proteolysis
GO:0050909 sensory perception of taste
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1xki, PDBe:1xki, PDBj:1xki
PDBsum1xki
PubMed15489503
UniProtP31025|LCN1_HUMAN Lipocalin-1 (Gene Name=LCN1)

[Back to BioLiP]