Structure of PDB 1xhv Chain A

Receptor sequence

>1xhvA (length=254) Species: 727 (Haemophilus influenzae)

SFIKPIYQDINSILIGQKVKRPTLSGHAAGEPFEKLVYKFLKENLSDLTF
KQYEYLNDLFMKNPAIIGHEARYKLFNSPTLLFLLSRGKAATENWSIENL
FEEKQNDTADILLVKDQFYELLDVKTRNISKSAQAPNIISAYKLAQTCAK
MIDNKEFDLFDINYLEVDWELNGEDLVCVSTSFAELFKSEPSELYINWAA
AMQIQFHVRDLDQGFNGTREEWAKSYLKHFVTQAEQRAISMIDKFVKPFK
KYIL

3D structure

• PDB: 1xhv Mechanistic Insights from the Structures of HincII Bound to Cognate DNA Cleaved from Addition of Mg(2+) and Mn(2+)
• Chain: A
• Resolution: 2.5 Å

Enzymatic activity

• Enzyme Commision number: 3.1.21.4: type II site-specific deoxyribonuclease.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	Q138 Y199 N201 A203 R241 K248	Q134 Y195 N197 A199 R237 K244
BS02	dna	A	E74 Y77 G92 K93 Q109	E70 Y73 G88 K89 Q105
BS03	dna	A	Q109 N110 I143 S144 Y146 K147 Q207	Q105 N106 I139 S140 Y142 K143 Q203
BS04	dna	A	E38 D114 T130 N132 S136 A137 Q138 P140 N141	E34 D110 T126 N128 S132 A133 Q134 P136 N137
BS05	MN	A	E38 D114 V128	E34 D110 V124
BS06	MN	A	H73 E74	H69 E70

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0004519 endonuclease activity
• GO:0009036 type II site-specific deoxyribonuclease activity

Biological Process

• GO:0009307 DNA restriction-modification system

External links

• PDB: RCSB:1xhv, PDBe:1xhv, PDBj:1xhv
• PDBsum: 1xhv
• PubMed: 15476804
• UniProt: P17743|T2C2_HAEIF Type II restriction enzyme HincII (Gene Name=hincIIR)