Structure of PDB 1xhu Chain A

Receptor sequence

>1xhuA (length=257) Species: 727 (Haemophilus influenzae)

SFIKPIYQDINSILIGQKVKRPKSGTLSGHAAGEPFEKLVYKFLKENLSD
LTFKQYEYLNDLFMKNPAIIGHEARYKLFNSPTLLFLLSRGKAATENWSI
ENLFEEKQNDTADILLVKDQFYELLDVKTRNISKSAQAPNIISAYKLAQT
CAKMIDNKEFDLFDINYLEVDWELNGEDLVCVSTSFAELFKSEPSELYIN
WAAAMQIQFHVRDLDQGFNGTREEWAKSYLKHFVTQAEQRAISMIDKFVK
PFKKYIL

3D structure

• PDB: 1xhu Mechanistic Insights from the Structures of HincII Bound to Cognate DNA Cleaved from Addition of Mg(2+) and Mn(2+)
• Chain: A
• Resolution: 2.95 Å

Enzymatic activity

• Enzyme Commision number: 3.1.21.4: type II site-specific deoxyribonuclease.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	Q138 Y199 N201 A203 A204 R241 K248	Q137 Y198 N200 A202 A203 R240 K247
BS02	dna	A	H31 Y77 G92 K108 Q109	H30 Y76 G91 K107 Q108
BS03	dna	A	Q109 S144 Y146 K147 A205 Q207	Q108 S143 Y145 K146 A204 Q206
BS04	dna	A	G30 H31 D114 T130 R131 N132 K135 S136 A137 Q138 N141	G29 H30 D113 T129 R130 N131 K134 S135 A136 Q137 N140

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0004519 endonuclease activity
• GO:0009036 type II site-specific deoxyribonuclease activity

Biological Process

• GO:0009307 DNA restriction-modification system

External links

• PDB: RCSB:1xhu, PDBe:1xhu, PDBj:1xhu
• PDBsum: 1xhu
• PubMed: 15476804
• UniProt: P17743|T2C2_HAEIF Type II restriction enzyme HincII (Gene Name=hincIIR)