Structure of PDB 1xh9 Chain A

Receptor sequence

>1xh9A (length=338) Species: 9913 (Bos taurus) [Search protein sequence]

ESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKH
METGNHYAMKILDKQKVVKLKEIEHTLNEKRILQAVNFPFLVKLEFSFKD
NSNLYMVMEYAPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDL
IYRDLKPENLMIDQQGYIKVTDFGLAKRVKGRTWTLCGTPEYLAPEIILS
KGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFS
SDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEA
PFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF

3D structure

PDB

1xh9 Design and crystal structures of protein kinase B-selective inhibitors in complex with protein kinase A and mutants

Chain

Resolution

1.64 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	D166 K168 E170 N171 D184 T201
Catalytic site (residue number reindexed from 1)	D154 K156 E158 N159 D172 T189
Enzyme Commision number	2.7.11.11: cAMP-dependent protein kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	E84 H87 E127 F129 R133 E170 T197 L198 C199 G200 E203 E230 Y235 P236 F239 D241 I246 D328 Y330	E72 H75 E115 F117 R121 E158 T185 L186 C187 G188 E191 E218 Y223 P224 F227 D229 I234 D316 Y318
BS02	R69	A	G50 T51 G52 F54 V57 A70 K72 L74 E84 E91 A123 E127 E170 N171 M173 T183 D184 G186 F327	G38 T39 G40 F42 V45 A58 K60 L62 E72 E79 A111 E115 E158 N159 M161 T171 D172 G174 F315	MOAD: Kd=17nM PDBbind-CN: -logKd/Ki=7.77,Kd=17nM BindingDB: IC50=30nM
BS03	BU3	A	P141 R144 T299 T300	P129 R132 T287 T288
BS04	BU3	A	F54 G55 R56 I73 D75 N115	F42 G43 R44 I61 D63 N103
BS05	BU3	A	E155 N289 K292	E143 N277 K280

Gene Ontology

	Molecular Function
GO:0004672	protein kinase activity
GO:0004674	protein serine/threonine kinase activity
GO:0004679	AMP-activated protein kinase activity
GO:0004691	cAMP-dependent protein kinase activity
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0019904	protein domain specific binding
GO:0034237	protein kinase A regulatory subunit binding
GO:0106310	protein serine kinase activity

	Biological Process
GO:0001707	mesoderm formation
GO:0006468	protein phosphorylation
GO:0010737	protein kinase A signaling
GO:0016310	phosphorylation
GO:0018105	peptidyl-serine phosphorylation
GO:0034605	cellular response to heat
GO:1904262	negative regulation of TORC1 signaling

	Cellular Component
GO:0001669	acrosomal vesicle
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0005952	cAMP-dependent protein kinase complex
GO:0031594	neuromuscular junction
GO:0036126	sperm flagellum
GO:0048471	perinuclear region of cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1xh9, PDBe:1xh9, PDBj:1xh9
PDBsum	1xh9
PubMed	15634010
UniProt	P00517\|KAPCA_BOVIN cAMP-dependent protein kinase catalytic subunit alpha (Gene Name=PRKACA)

[Back to BioLiP]