Structure of PDB 1xf6 Chain A

Receptor sequence
>1xf6A (length=76) Species: 79257 (Rhodomonas sp. CS24) [Search protein sequence]
AMDKSAKAPQITIFDHRGCSRAPKESTGGKAGGQDDEMMVKVASTKVTVS
ESDAAKKLQEFITFEKGIDGPFTSKN
3D structure
PDB1xf6 Developing a structure-function model for the cryptophyte phycoerythrin 545 using ultrahigh resolution crystallography and ultrafast laser spectroscopy
ChainA
Resolution1.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 DBV A F14 C19 R21 P23 E25 S26 E37 M38 M39 K41 F14 C19 R21 P23 E25 S26 E37 M38 M39 K41
BS02 PEB A F64 E65 K66 D69 G70 P71 F72 T73 S74 F64 E65 K66 D69 G70 P71 F72 T73 S74
BS03 PEB A R17 Q34 M38 R17 Q34 M38
BS04 PEB A M2 K4 A6 M2 K4 A6
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:1xf6, PDBe:1xf6, PDBj:1xf6
PDBsum1xf6
PubMed15504407
UniProtQ00433|PHE3_RHDS2 Phycoerythrin alpha-3 chain, chloroplastic (Gene Name=cpeA3)

[Back to BioLiP]