Structure of PDB 1x7d Chain A

Receptor sequence

>1x7dA (length=340) Species: 303 (Pseudomonas putida)

TYFIDVPTMSDLVHDIGVAPFIGELAAALRDDFKRWQAFDKSARVASHSE
VGVIELMPVADKSRYAFKYVNGHPANTARNLHTVMAFGVLADVDSGYPVL
LSELTIATALRTAATSLMAAQALARPNARKMALIGNGAQSEFQALAFHKH
LGIEEIVAYDTDPLATAKLIANLKEYSGLTIRRASSVAEAVKGVDIITTV
TADKAYATIITPDMLEPGMHLNAVGGDCPGKTELHADVLRNARVFVEYEP
QTRIEGEIQQLPADFPVVDLWRVLRGETEGRQSDSQVTVFDSVGFALEDY
TVLRYVLQQAEKRGMGTKIDLVPWVEDDPKDLFSHTRGRA

3D structure

• PDB: 1x7d Ornithine Cyclodeaminase: Structure, Mechanism of Action, and Implications for the u-Crystallin Family
• Chain: A
• Resolution: 1.6 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E56 D228
• Catalytic site (residue number reindexed from 1): E55 D227
• Enzyme Commision number: 4.3.1.12: ornithine cyclodeaminase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAD	A	T84 R112 T113 G138 A139 Q140 D161 T162 V201 T202 A203 I210 V225 G226 D228 K232 S293 V294 G295	T83 R111 T112 G137 A138 Q139 D160 T161 V200 T201 A202 I209 V224 G225 D227 K231 S292 V293 G294
BS02	ORN	A	R45 V54 E56 M58 K69 V71 N72 G73 R112 D228 V294	R44 V53 E55 M57 K68 V70 N71 G72 R111 D227 V293

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0008473 ornithine cyclodeaminase activity
• GO:0016829 lyase activity

Biological Process

• GO:0008652 amino acid biosynthetic process
• GO:0055129 L-proline biosynthetic process

External links

• PDB: RCSB:1x7d, PDBe:1x7d, PDBj:1x7d
• PDBsum: 1x7d
• PubMed: 15518536
• UniProt: Q88H32|OCD_PSEPK Ornithine cyclodeaminase (Gene Name=ocd)