Structure of PDB 1x3c Chain A |
>1x3cA (length=73) Species: 9606 (Homo sapiens) [Search protein sequence] |
GSSGSSGRKKPVSQSLEFPTRYSPYRPYRCVHQGCFAAFTIQQNLILHYQ AVHKSDLPAFSAEVEEESGPSSG |
|
PDB | 1x3c Solution structure of the C2H2 type zinc-binding domain of human zinc finger protein 292 |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C30 C35 H48 H53 |
C30 C35 H48 H53 |
|
|
|