Structure of PDB 1x0x Chain A

Receptor sequence
>1x0xA (length=350) Species: 9606 (Homo sapiens) [Search protein sequence]
SMASKKVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDIGGKK
LTEIINTQHENVKYLPGHKLPPNVVAVPDVVQAAEDADILIFVVPHQFIG
KICDQLKGHLKANATGISLIKGVDEGPNGLKLISEVIGERLGIPMSVLMG
ANIASEVADEKFCETTIGCKDPAQGQLLKELMQTPNFRITVVQEVDTVEI
CGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLFCSGPVSS
ATFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQG
PETARELYSILQHKGLVDKFPLFMAVYKVCYEGQPVGEFIHCLQNHPEHM
3D structure
PDB1x0x Crystal Structures of Human Glycerol 3-phosphate Dehydrogenase 1 (GPD1)
ChainA
Resolution2.75 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) K204 T264
Catalytic site (residue number reindexed from 1) K205 T265
Enzyme Commision number 1.1.1.8: glycerol-3-phosphate dehydrogenase (NAD(+)).
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SO4 A K20 H67 K68 K21 H68 K69
BS02 SO4 A T264 G268 R269 N270 T265 G269 R270 N271
BS03 SO4 A K240 S249 K241 S250
BS04 NAD A G12 N13 W14 F41 Y63 V92 V93 P94 F97 K120 N151 A153 R269 Q295 K296 G13 N14 W15 F42 Y64 V93 V94 P95 F98 K121 N152 A154 R270 Q296 K297
Gene Ontology
Molecular Function
GO:0004368 glycerol-3-phosphate dehydrogenase (quinone) activity
GO:0005515 protein binding
GO:0016491 oxidoreductase activity
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0042803 protein homodimerization activity
GO:0047952 glycerol-3-phosphate dehydrogenase [NAD(P)+] activity
GO:0051287 NAD binding
GO:0141152 glycerol-3-phosphate dehydrogenase (NAD+) activity
Biological Process
GO:0005975 carbohydrate metabolic process
GO:0006072 glycerol-3-phosphate metabolic process
GO:0006094 gluconeogenesis
GO:0006116 NADH oxidation
GO:0006127 glycerophosphate shuttle
GO:0006734 NADH metabolic process
GO:0045821 positive regulation of glycolytic process
GO:0046168 glycerol-3-phosphate catabolic process
GO:0046486 glycerolipid metabolic process
GO:0071320 cellular response to cAMP
GO:0071356 cellular response to tumor necrosis factor
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1x0x, PDBe:1x0x, PDBj:1x0x
PDBsum1x0x
PubMed16460752
UniProtP21695|GPDA_HUMAN Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic (Gene Name=GPD1)

[Back to BioLiP]