Structure of PDB 1x0t Chain A |
>1x0tA (length=106) Species: 70601 (Pyrococcus horikoshii OT3) [Search protein sequence] |
IVKRRDWEKKEKKKIAIERIDTLFTLAERVARYSPDLAKRYVELALEIQK KAKVKIPRKWKRRYCKRCHTFLIPGVNARVRLRTKRMPHVVITCLECGYI MRYPYL |
|
PDB | 1x0t Crystal Structure of a Ribonuclease P Protein Ph1601p from Pyrococcus horikoshii OT3: An Archaeal Homologue of Human Nuclear Ribonuclease P Protein Rpp21(,) |
Chain | A |
Resolution | 1.6 Å |
3D structure |
|
|
Enzyme Commision number |
3.1.26.5: ribonuclease P. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C68 C71 C97 C100 |
C65 C68 C94 C97 |
|
|
|
|