Structure of PDB 1wpq Chain A

Receptor sequence
>1wpqA (length=348) Species: 9606 (Homo sapiens) [Search protein sequence]
ASKKVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDIGGKKLT
EIINTQHENVKYLPGHKLPPNVVAVPDVVQAAEDADILIFVVPHQFIGKI
CDQLKGHLKANPTGISLIKGVDEGPNGLKLISEVIGERLGIPMSVLMGAN
IASEVADEKFCETTIGCKDPAQGQLLKELMQTPNFRITVVQEVDTVEICG
ALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLFCSGPVSSAT
FLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGPE
TARELYSILQHKGLVDKFPLFMAVYKVCYEGQPVGEFIHCLQNHPEHM
3D structure
PDB1wpq Crystal Structures of Human Glycerol 3-phosphate Dehydrogenase 1 (GPD1)
ChainA
Resolution2.5 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) K204 T264
Catalytic site (residue number reindexed from 1) K203 T263
Enzyme Commision number 1.1.1.8: glycerol-3-phosphate dehydrogenase (NAD(+)).
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SO4 A K20 H67 K68 K19 H66 K67
BS02 SO4 A K178 Q182 R187 K177 Q181 R186
BS03 NAD A G12 N13 W14 F41 Y63 P94 F97 K120 A153 R269 Q295 K296 Q298 G11 N12 W13 F40 Y62 P93 F96 K119 A152 R268 Q294 K295 Q297
Gene Ontology
Molecular Function
GO:0004368 glycerol-3-phosphate dehydrogenase (quinone) activity
GO:0005515 protein binding
GO:0016491 oxidoreductase activity
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0042803 protein homodimerization activity
GO:0047952 glycerol-3-phosphate dehydrogenase [NAD(P)+] activity
GO:0051287 NAD binding
GO:0141152 glycerol-3-phosphate dehydrogenase (NAD+) activity
Biological Process
GO:0005975 carbohydrate metabolic process
GO:0006072 glycerol-3-phosphate metabolic process
GO:0006094 gluconeogenesis
GO:0006116 NADH oxidation
GO:0006127 glycerophosphate shuttle
GO:0006734 NADH metabolic process
GO:0045821 positive regulation of glycolytic process
GO:0046168 glycerol-3-phosphate catabolic process
GO:0046486 glycerolipid metabolic process
GO:0071320 cellular response to cAMP
GO:0071356 cellular response to tumor necrosis factor
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1wpq, PDBe:1wpq, PDBj:1wpq
PDBsum1wpq
PubMed16460752
UniProtP21695|GPDA_HUMAN Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic (Gene Name=GPD1)

[Back to BioLiP]