Structure of PDB 1wpc Chain A

Receptor sequence

>1wpcA (length=481) Species: 1416 (Bacillus sp. 707) [Search protein sequence]

TNGTMMQYFEWYLPNDGNHWNRLNSDASNLKSKGITAVWIPPAWKGASQN
DVGYGAYDLYDLGEFNQKGTVRTKYGTRSQLQAAVTSLKNNGIQVYGDVV
MNHKGGADATEMVRAVEVNPNNRNQEVTGEYTIEAWTRFDFPGRGNTHSS
FKWRWYHFDGVDWDQSRRLNNRIYKFRGHGKAWDWEVDTENGNYDYLMYA
DIDMDHPEVVNELRNWGVWYTNTLGLDGFRIDAVKHIKYSFTRDWINHVR
SATGKNMFAVAEFWKNDLGAIENYLQKTNWNHSVFDVPLHYNLYNASKSG
GNYDMRNIFNGTVVQRHPSHAVTFVDNHDSQPEEALESFVEEWFKPLAYA
LTLTREQGYPSVFYGDYYGIPTHGVPAMRSKIDPILEARQKYAYGKQNDY
LDHHNIIGWTREGNTAHPNSGLATIMSDGAGGSKWMFVGRNKAGQVWSDI
TGNRTGTVTINADGWGNFSVNGGSVSIWVNK

3D structure

PDB

1wpc Biochemical and crystallographic analyses of maltohexaose-producing amylase from alkalophilic Bacillus sp. 707

Chain

Resolution

1.9 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	D236 E266 D333
Catalytic site (residue number reindexed from 1)	D232 E262 D329
Enzyme Commision number	3.2.1.98: glucan 1,4-alpha-maltohexaosidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	GLC	A	W15 M202	W11 M198
BS02	GLC	A	D166 M202 Y203	D162 M198 Y199
BS03	GLD	A	G110 W140	G106 W136
BS04	GLC	A	E194 Y198 K239 L340	E190 Y194 K235 L336
BS05	GLD	A	A237 H240 E266	A233 H236 E262
BS06	GLC	A	W284 H321 H324	W280 H317 H320
BS07	GLC	A	Y160 H210 E212	Y156 H206 E208
BS08	ACI	A	G110 A111 W140	G106 A107 W136
BS09	ACI	A	Y58 H107 M202 D236 E266 H332 D333	Y54 H103 M198 D232 E262 H328 D329
BS10	CA	A	D163 A186 D188 D207 D209	D159 A182 D184 D203 D205
BS11	CA	A	N106 D199 D205 H240	N102 D195 D201 H236
BS12	CA	A	G305 Y307 H408 N409 D432	G301 Y303 H404 N405 D428

Gene Ontology

	Molecular Function
GO:0004553	hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004556	alpha-amylase activity
GO:0005509	calcium ion binding
GO:0016798	hydrolase activity, acting on glycosyl bonds
GO:0033927	glucan 1,4-alpha-maltohexaosidase activity
GO:0043169	cation binding
GO:0046872	metal ion binding

	Biological Process
GO:0005975	carbohydrate metabolic process
GO:0005983	starch catabolic process

	Cellular Component
GO:0005576	extracellular region

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1wpc, PDBe:1wpc, PDBj:1wpc
PDBsum	1wpc
PubMed	15518553
UniProt	P19571\|AMT6_BACS7 Glucan 1,4-alpha-maltohexaosidase

[Back to BioLiP]