Structure of PDB 1wop Chain A

Receptor sequence

>1wopA (length=362) Species: 2336 (Thermotoga maritima)

MKRTPLFEKHVELGAKMVDFAGWEMPLYYTSIFEEVMAVRKSVGMFDVSH
MGEFLVKGPEAVSFIDFLITNDFSSLPDGKAIYSVMCNENGGIIDDLVVY
KVSPDEALMVVNAANIEKDFNWIKSHSKNFDVEVSNISDTTALIAFQGPK
AQETLQELVEDGLEEIAYYSFRKSIVAGVETLVSRTGYTGEDGFELMLEA
KNAPKVWDALMNLLRKIDGRPAGLGARDVCRLEATYLLYGQDMDENTNPF
EVGLSWVVKLNKDFVGKEALLKAKEKVERKLVALELSGKRIARKGYEVLK
NGERVGEITSGNFSPTLGKSIALALVSKSVKIGDQLGVVFPGGKLVEALV
VKKPFYRGSVRR

3D structure

• PDB: 1wop Crystal Structure of T-protein of the Glycine Cleavage System: Cofactor binding, insights into H-protein recognition, and molecular basis for understanding nonketotic hyperglycinemia
• Chain: A
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D96
• Catalytic site (residue number reindexed from 1): D96
• Enzyme Commision number: 2.1.2.10: aminomethyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FFO	A	M51 Y83 D96 V98 V110 N112 Y168 Y169 Y188 E195 R227 Y236 R362	M51 Y83 D96 V98 V110 N112 Y168 Y169 Y188 E195 R227 Y236 R362
BS02	FFO	A	L55 E106 L108 I137 E160 K173 S174 I175 E180 T181 M197	L55 E106 L108 I137 E160 K173 S174 I175 E180 T181 M197

Gene Ontology

Molecular Function

• GO:0004047 aminomethyltransferase activity
• GO:0008483 transaminase activity

Biological Process

• GO:0006546 glycine catabolic process
• GO:0019464 glycine decarboxylation via glycine cleavage system

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005960 glycine cleavage complex

External links

• PDB: RCSB:1wop, PDBe:1wop, PDBj:1wop
• PDBsum: 1wop
• PubMed: 15355973
• UniProt: Q9WY54|GCST_THEMA Aminomethyltransferase (Gene Name=gcvT)