Structure of PDB 1wlj Chain A

Receptor sequence

>1wljA (length=168) Species: 9606 (Homo sapiens)

EVVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTR
VSGVTPQHMVGATPFAVARLEILQLLKGKLVVGHDLKHDFQALKEDMSGY
TIYDTSTDRLLWREAKLVSLRVLSERLLHKSIQNSLLGHSSVEDARATME
LYQISQRIRARRGLPRLA

3D structure

• PDB: 1wlj Crystal structure of human ISG20, an interferon-induced antiviral ribonuclease
• Chain: A
• Resolution: 1.9 Å

Enzymatic activity

• Enzyme Commision number: 3.1.13.1: exoribonuclease II.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	A	D11 E13 D154	D6 E8 D144
BS02	MN	A	D90 H93	D85 H88
BS03	U5P	A	D11 E13 M14 R53 S57 H149	D6 E8 M9 R48 S52 H139

Gene Ontology

Molecular Function

• GO:0000175 3'-5'-RNA exonuclease activity
• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0004527 exonuclease activity
• GO:0008310 single-stranded DNA 3'-5' DNA exonuclease activity
• GO:0008859 exoribonuclease II activity
• GO:0030619 U1 snRNA binding
• GO:0030620 U2 snRNA binding
• GO:0034511 U3 snoRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006308 DNA catabolic process
• GO:0006364 rRNA processing
• GO:0006401 RNA catabolic process
• GO:0009615 response to virus
• GO:0045071 negative regulation of viral genome replication
• GO:0045087 innate immune response
• GO:0051607 defense response to virus

Cellular Component

• GO:0000932 P-body
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0015030 Cajal body
• GO:0016605 PML body

External links

• PDB: RCSB:1wlj, PDBe:1wlj, PDBj:1wlj
• PDBsum: 1wlj
• PubMed: 15527770
• UniProt: Q96AZ6|ISG20_HUMAN Interferon-stimulated gene 20 kDa protein (Gene Name=ISG20)