Structure of PDB 1wkl Chain A

Receptor sequence

>1wklA (length=137) Species: 274 (Thermus thermophilus)

MERTFVMIKPDGVRRGLVGEILARFERKGFRIAALKLMQISQELAERHYA
EHREKPFFPGLVRFITSGPVVAMVLEGPGVVAEVRKMMGATHPKDALPGT
IRGDFATTIDENVIHGSATLEDAQREIALFFRPEELL

3D structure

• PDB: 1wkl Crystal Structure of Nucleoside Diphosphate Kinase from Thermus thermophilus HB8
• Chain: A
• Resolution: 2.2 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K9 Y49 N112 H115 E126
• Catalytic site (residue number reindexed from 1): K9 Y49 N112 H115 E126
• Enzyme Commision number: 2.7.4.6: nucleoside-diphosphate kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PHS	A	K9 H48 Y49 H115	K9 H48 Y49 H115
BS02	ADP	A	Y49 H52 F57 T91 R102 I109 D110 N112	Y49 H52 F57 T91 R102 I109 D110 N112

Gene Ontology

Molecular Function

• GO:0004550 nucleoside diphosphate kinase activity
• GO:0005524 ATP binding
• GO:0016301 kinase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006183 GTP biosynthetic process
• GO:0006228 UTP biosynthetic process
• GO:0006241 CTP biosynthetic process
• GO:0009117 nucleotide metabolic process
• GO:0016310 phosphorylation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:1wkl, PDBe:1wkl, PDBj:1wkl
• PDBsum: 1wkl
• UniProt: Q5SLV5|NDK_THET8 Nucleoside diphosphate kinase (Gene Name=ndk)