Structure of PDB 1wjf Chain A |
>1wjfA (length=55) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
FLDGIDKAQEECEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAM HGQVD |
|
PDB | 1wjf Solution structure of the His12 --> Cys mutant of the N-terminal zinc binding domain of HIV-1 integrase complexed to cadmium. |
Chain | A |
Resolution | N/A |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CD |
A |
C12 C40 |
C12 C40 |
|
|
|
|