Structure of PDB 1wjd Chain A |
>1wjdA (length=55) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAM HGQVD |
|
PDB | 1wjd Solution structure of the N-terminal zinc binding domain of HIV-1 integrase. |
Chain | A |
Resolution | N/A |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
H12 H16 C40 C43 |
H12 H16 C40 C43 |
|
|
|
|