Structure of PDB 1wad Chain A

Receptor sequence

>1wadA (length=111) Species: 879 (Megalodesulfovibrio gigas)

VDVPADGAKIDFIAGGEKNLTVVFNHSTHKDVKCDDCHHDPGDKQYAGCT
TDGCHNILDKADKSVNSWYKVVHDAKGGAKPTCISCHKDKAGDDKELKKK
LTGCKGSACHP

3D structure

• PDB: 1wad Cytochrome c3 from Desulfovibrio gigas: crystal structure at 1.8 A resolution and evidence for a specific calcium-binding site.
• Chain: A
• Resolution: 1.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	D11 I13 N19 L20	D11 I13 N19 L20
BS02	HEM	A	V1 P4 F12 F24 H26 H29 V32 C34 C37 H38 Y46 G48 C49	V1 P4 F12 F24 H26 H29 V32 C34 C37 H38 Y46 G48 C49
BS03	HEM	A	C37 H38 H39 C49 C54 H55 V65 G78 A79 K80 P81	C37 H38 H39 C49 C54 H55 V65 G78 A79 K80 P81
BS04	HEM	A	N25 T28 H29 C83 C86 H87 A108 C109	N25 T28 H29 C83 C86 H87 A108 C109
BS05	HEM	A	D11 F12 I13 G15 N19 L20 V22 W68 Y69 V72 H73 H87 T102 G103 C104 C109 H110	D11 F12 I13 G15 N19 L20 V22 W68 Y69 V72 H73 H87 T102 G103 C104 C109 H110

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009061 anaerobic respiration

External links

• PDB: RCSB:1wad, PDBe:1wad, PDBj:1wad
• PDBsum: 1wad
• PubMed: 8819167
• UniProt: P00133|CYC3_MEGG1 Cytochrome c3