Structure of PDB 1w22 Chain A

Receptor sequence
>1w22A (length=352) Species: 9606 (Homo sapiens) [Search protein sequence]
SLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVA
SMEEMATFHTDAYLQHLQKVSQEYGLGYDCPATEGIFDYAAAIGGATITA
AQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERI
LYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKG
RYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGD
PMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVI
LGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRIQQILNYIKGN
LK
3D structure
PDB1w22 Crystal Structure of a Eukaryotic Zn-Dependent Histone Deacetylase,Human Hdac8,Complexed with a Hydroxamic Acid Inhibitor
ChainA
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.5.1.-
3.5.1.98: histone deacetylase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A D178 H180 D267 D156 H158 D245
BS02 K A D176 L177 D178 L179 H180 H181 S199 L200 H201 D154 L155 D156 L157 H158 H159 S177 L178 H179
BS03 K A F189 S190 T192 V195 M196 G222 Y225 S226 F167 S168 T170 V173 M174 G200 Y203 S204
BS04 NHB A D101 H142 H143 G151 F152 D178 H180 F208 Y306 D79 H120 H121 G129 F130 D156 H158 F186 Y284 MOAD: ic50=175.5nM
PDBbind-CN: -logKd/Ki=6.76,IC50=175.5nM
BS05 NHB A F152 P273 Y306 F130 P251 Y284 MOAD: ic50=175.5nM
PDBbind-CN: -logKd/Ki=6.76,IC50=175.5nM
Gene Ontology
Molecular Function
GO:0004407 histone deacetylase activity
GO:0005515 protein binding
GO:0016787 hydrolase activity
GO:0030544 Hsp70 protein binding
GO:0033558 protein lysine deacetylase activity
GO:0046872 metal ion binding
GO:0051879 Hsp90 protein binding
GO:0140297 DNA-binding transcription factor binding
GO:0160008 protein decrotonylase activity
GO:0160009 histone decrotonylase activity
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006325 chromatin organization
GO:0007064 mitotic sister chromatid cohesion
GO:0031397 negative regulation of protein ubiquitination
GO:0031647 regulation of protein stability
GO:0032204 regulation of telomere maintenance
GO:0040029 epigenetic regulation of gene expression
Cellular Component
GO:0000118 histone deacetylase complex
GO:0000228 nuclear chromosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1w22, PDBe:1w22, PDBj:1w22
PDBsum1w22
PubMed15477595
UniProtQ9BY41|HDAC8_HUMAN Histone deacetylase 8 (Gene Name=HDAC8)

[Back to BioLiP]