Structure of PDB 1vsf Chain A |
>1vsfA (length=146) Species: 11889 (Rous sarcoma virus (strain Schmidt-Ruppin)) [Search protein sequence] |
GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQH HWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQ AMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF |
|
PDB | 1vsf The catalytic domain of avian sarcoma virus integrase: conformation of the active-site residues in the presence of divalent cations. |
Chain | A |
Resolution | 2.05 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MN |
A |
D64 D121 |
D11 D68 |
|
|
|
|