Structure of PDB 1vm6 Chain A

Receptor sequence

>1vm6A (length=215) Species: 2336 (Thermotoga maritima)

HMKYGIVGYSGRMGQEIQKVFSEKGHELVLKVDVNGVEELDSPDVVIDFS
SPEALPKTVDLCKKYRAGLVLGTTALKEEHLQMLRELSKEVPVVQAYNFS
IGINVLKRFLSELVKVLEDWDVEIVETHHRFKKDAPSGTAILLESALGKS
VPIHSLRVGGVPGDHVVVFGNIGETIEIKHRAISRTVFAIGALKAAEFLV
GKDPGMYSFEEVIFG

3D structure

• PDB: 1vm6 Crystal structure of Dihydrodipicolinate reductase (TM1520) from Thermotoga maritima at 2.27 A resolution
• Chain: A
• Resolution: 2.27 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H127 K131
• Catalytic site (residue number reindexed from 1): H128 K132
• Enzyme Commision number: 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAD	A	G7 G10 R11 M12 D32 V33 F48 S49 S50 A53 G71 T73 Y96 N97 F98 F187	G8 G11 R12 M13 D33 V34 F49 S50 S51 A54 G72 T74 Y97 N98 F99 F188

Gene Ontology

Molecular Function

• GO:0008839 4-hydroxy-tetrahydrodipicolinate reductase
• GO:0016491 oxidoreductase activity
• GO:0016726 oxidoreductase activity, acting on CH or CH2 groups, NAD or NADP as acceptor
• GO:0050661 NADP binding
• GO:0051287 NAD binding

Biological Process

• GO:0009085 lysine biosynthetic process
• GO:0009089 lysine biosynthetic process via diaminopimelate
• GO:0019877 diaminopimelate biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:1vm6, PDBe:1vm6, PDBj:1vm6
• PDBsum: 1vm6
• UniProt: Q9X1K8|DAPB_THEMA 4-hydroxy-tetrahydrodipicolinate reductase (Gene Name=dapB)