Structure of PDB 1v9x Chain A |
>1v9xA (length=114) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] |
GSSGSSGHKPWRAEYAKSSRSSCKTCKSVINKENFRLGKLVQSTHFDGIM PMWNHASCILKKTKQIKSVDDVEGIESLRWEDQQKIRKYVESGAGSNTST STGTSTSSSGPSSG |
|
PDB | 1v9x Solution structure of the first Zn-finger domain of poly(ADP-ribose) polymerase-1 |
Chain | A |
Resolution | N/A |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C23 C26 H55 C58 |
C23 C26 H55 C58 |
|
|
|
|