Structure of PDB 1v1q Chain A

Receptor sequence
>1v1qA (length=110) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
PNSLMTNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQA
WCQMPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQ
IELIDSVDKL
3D structure
PDB1v1q Crystal Structure of Prib- a Primosomal DNA Replication Protein of Escherichia Coli
ChainA
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CYS A C12 R13 V30 Q49 C16 R17 V34 Q53
BS02 CYS A P15 L16 R17 C27 H64 P19 L20 R21 C31 H68
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003697 single-stranded DNA binding
GO:0005515 protein binding
GO:0042802 identical protein binding
Biological Process
GO:0006260 DNA replication
GO:0006268 DNA unwinding involved in DNA replication
GO:0006269 DNA replication, synthesis of primer
GO:0006270 DNA replication initiation
GO:0006276 plasmid maintenance
GO:0009314 response to radiation
GO:0031297 replication fork processing
Cellular Component
GO:0030894 replisome
GO:1990077 primosome complex
GO:1990099 pre-primosome complex
GO:1990158 DnaB-DnaC-DnaT-PriA-PriB complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1v1q, PDBe:1v1q, PDBj:1v1q
PDBsum1v1q
PubMed15383524
UniProtP07013|PRIB_ECOLI Primosomal replication protein N (Gene Name=priB)

[Back to BioLiP]