Structure of PDB 1uzn Chain A

Receptor sequence

>1uznA (length=239) Species: 83332 (Mycobacterium tuberculosis H37Rv)

AKPPFVSRSVLVTGGNRGIGLAIAQRLAADGHKVAVTHRGSGAPKGLFGV
EVDVTDSDAVDRAFTAVEEHQGPVEVLVSNAGLSADAFLMRMTEEKFEKV
INANLTGAFRVAQRASRSMQRNKFGRMIFIGSVSGLWGIGNQANYAASKA
GVIGMARSIARELSKANVTANVVAPGYIDTDMTRALDERIQQGALQFIPA
KRVGTPAEVAGVVSFLASEDASYISGAVIPVDGGMGMGH

3D structure

• PDB: 1uzn Crystal Structure of Maba from Mycobacterium Tuberculosis, a Reductase Involved in Long-Chain Fatty Acid Biosynthesis.
• Chain: A
• Resolution: 1.91 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): G26 S140 Y153 K157
• Catalytic site (residue number reindexed from 1): G18 S132 Y145 K149
• Enzyme Commision number: 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
  1.1.1.36: acetoacetyl-CoA reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	A	G22 N24 R25 I27 R47 D61 V62 A89 G90	G14 N16 R17 I19 R39 D53 V54 A81 G82	MOAD: Kd=11.2uM

Gene Ontology

Molecular Function

• GO:0004316 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity
• GO:0005515 protein binding
• GO:0016491 oxidoreductase activity
• GO:0018454 acetoacetyl-CoA reductase activity
• GO:0070402 NADPH binding

Biological Process

• GO:0006633 fatty acid biosynthetic process
• GO:0046459 short-chain fatty acid metabolic process
• GO:0071768 mycolic acid biosynthetic process

Cellular Component

• GO:0005576 extracellular region
• GO:0005886 plasma membrane

External links

• PDB: RCSB:1uzn, PDBe:1uzn, PDBj:1uzn
• PDBsum: 1uzn
• PubMed: 12079383
• UniProt: P9WGT3|MABA_MYCTU 3-oxoacyl-[acyl-carrier-protein] reductase MabA (Gene Name=mabA)