Structure of PDB 1uvx Chain A

Receptor sequence
>1uvxA (length=121) Species: 3054 (Chlamydomonas moewusii) [Search protein sequence]
SLFAKLGGREAVEAAVDKFYNKIVADPTVSTYFSNTDMKVQRSKQFAFLA
YALGGASEWKGKDMRTAHKDLVPHLSDVHFQAVARHLSDTLTELGVPPED
ITDAMAVVASTRTEVLNMPQQ
3D structure
PDB1uvx Heme-Ligand Tunneling in Group I Truncated Hemoglobins
ChainA
Resolution2.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM A V29 Y32 F33 T36 Q41 K44 Q45 F48 K62 M64 H68 L71 L75 H79 F80 V83 V29 Y32 F33 T36 Q41 K44 Q45 F48 K62 M64 H68 L71 L75 H79 F80 V83
BS02 CYN A Y20 F33 Y20 F33
BS03 XE A F19 Q45 F19 Q45
BS04 XE A A15 V16 F19 L87 A15 V16 F19 L87
BS05 XE A L6 A11 L6 A11
Gene Ontology
Molecular Function
GO:0019825 oxygen binding
GO:0020037 heme binding
Biological Process
GO:0015671 oxygen transport

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1uvx, PDBe:1uvx, PDBj:1uvx
PDBsum1uvx
PubMed15016811
UniProtQ08753|TRHN1_CHLMO Group 1 truncated hemoglobin LI637 (Gene Name=LI637)

[Back to BioLiP]