Structure of PDB 1urn Chain A

Receptor sequence
>1urnA (length=96) Species: 9606 (Homo sapiens) [Search protein sequence]
AVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKM
RGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
3D structure
PDB1urn Crystal structure at 1.92 A resolution of the RNA-binding domain of the U1A spliceosomal protein complexed with an RNA hairpin.
ChainA
Resolution1.92 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna A Y13 N15 N16 E19 K22 L49 K50 M51 R52 Q54 F56 K80 Q85 A87 K88 T89 D90 S91 D92 Y12 N14 N15 E18 K21 L48 K49 M50 R51 Q53 F55 K79 Q84 A86 K87 T88 D89 S90 D91
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:1urn, PDBe:1urn, PDBj:1urn
PDBsum1urn
PubMed7984237
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]