Structure of PDB 1upd Chain A

Receptor sequence

>1updA (length=107) Species: 876 (Desulfovibrio desulfuricans) [Search protein sequence]

APAVPDKPVEVKGSQKTVMFPHAPHEKVECVTCHHLVDGKESYAKCGSSG
CHDDLTAKKGEKSLYYVVHARGELKHTSCLACHSKVVAEKPELKKDLTGC
AKSKCHP

3D structure

PDB

1upd Molecular Basis for Redox-Bohr and Cooperative Effects in Cytochrome C3 from Desulfovibrio Desulfuricans Atcc 27774: Crystallographic and Modeling Studies of Oxidized and Reduced High-Resolution Structures at Ph 7.6

Chain

Resolution

1.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEC	A	P2 P5 F20 H22 H25 V28 C30 C33 H34 Y43 K45 C46	P2 P5 F20 H22 H25 V28 C30 C33 H34 Y43 K45 C46
BS02	HEC	A	C33 H35 V37 A44 C46 C51 H52 E61 V67 L74 K75 H76	C33 H35 V37 A44 C46 C51 H52 E61 V67 L74 K75 H76
BS03	HEC	A	F20 H25 C79 C82 H83 K90 L93 L97 K104	F20 H25 C79 C82 H83 K90 L93 L97 K104
BS04	HEC	A	V11 G13 S14 Q15 K16 V18 Y65 V68 H69 H83 L97 T98 G99 C100 C105 H106	V11 G13 S14 Q15 K16 V18 Y65 V68 H69 H83 L97 T98 G99 C100 C105 H106

Gene Ontology

	Molecular Function
GO:0009055	electron transfer activity
GO:0020037	heme binding
GO:0046872	metal ion binding

View graph for
Molecular Function

External links

PDB	RCSB:1upd, PDBe:1upd, PDBj:1upd
PDBsum	1upd
PubMed	14705030
UniProt	Q9L915

[Back to BioLiP]