Structure of PDB 1ujk Chain A

Receptor sequence

>1ujkA (length=145) Species: 9606 (Homo sapiens)

EPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLL
AHKIQSPQEWEAIQALTVLETCMKSCGKRFHDEVGKFRFLNELIKVVSPK
YLGSRTSEKVKNKILELLYSWTVGLPEEVKIAEAYQMLKKQGIVK

3D structure

• PDB: 1ujk Insights into the Phosphoregulation of beta-Secretase Sorting Signal by the VHS Domain of GGA1
• Chain: A
• Resolution: 1.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	K87 F88 R89 N92 Y102 K131 M138	K86 F87 R88 N91 Y101 K130 M137

Gene Ontology

Molecular Function

• GO:0031267 small GTPase binding
• GO:0035091 phosphatidylinositol binding
• GO:0043130 ubiquitin binding

Biological Process

• GO:0006886 intracellular protein transport

Cellular Component

• GO:0005802 trans-Golgi network

External links

• PDB: RCSB:1ujk, PDBe:1ujk, PDBj:1ujk
• PDBsum: 1ujk
• PubMed: 15117318
• UniProt: Q9UJY5|GGA1_HUMAN ADP-ribosylation factor-binding protein GGA1 (Gene Name=GGA1)