Structure of PDB 1uib Chain A

Receptor sequence

>1uibA (length=127) Species: 9031 (Gallus gallus)

KVFGRCELAAAMKGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTD
YGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDG
NGMNAWVAWRNRCKGTDVQAWIRGCRL

3D structure

• PDB: 1uib Fluctuations in free or substrate-complexed lysozyme and a mutant of it detected on x-ray crystallography and comparison with those detected on NMR.
• Chain: A
• Resolution: 1.76 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E35 N46 D48 S50 D52 N59
• Catalytic site (residue number reindexed from 1): E33 N44 D46 S48 D50 N57
• Enzyme Commision number: 3.2.1.17: lysozyme.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAG	A	N59 W62 W63 A107 W108	N57 W60 W61 A105 W106
BS02	NAG	A	W62 W63 D101	W60 W61 D99
BS03	NAG	A	D101 N103	D99 N101

Gene Ontology

Molecular Function

• GO:0003796 lysozyme activity
• GO:0005515 protein binding
• GO:0016231 beta-N-acetylglucosaminidase activity
• GO:0016798 hydrolase activity, acting on glycosyl bonds
• GO:0042802 identical protein binding

Biological Process

• GO:0016998 cell wall macromolecule catabolic process
• GO:0031640 killing of cells of another organism
• GO:0042742 defense response to bacterium
• GO:0050829 defense response to Gram-negative bacterium
• GO:0050830 defense response to Gram-positive bacterium

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0005783 endoplasmic reticulum

External links

• PDB: RCSB:1uib, PDBe:1uib, PDBj:1uib
• PDBsum: 1uib
• PubMed: 11983077
• UniProt: P00698|LYSC_CHICK Lysozyme C (Gene Name=LYZ)