Structure of PDB 1ubw Chain A

Receptor sequence

>1ubwA (length=348) Species: 9031 (Gallus gallus)

SPVVVEREREEFVGFFPQIVRDLTEDGIGHPEVGDAVARLKEVLQYNAPG
GKCNRGLTVVAAYRELSGPGQKDAESLRCALAVGWCIELFQAASLVADDI
MDQSLTRRGQLCWYKKEGVGLDAINDSFLLESSVYRVLKKYCRQRPYYVH
LLELFLQTAYQTELGQMLDLITAPVSKVDLSHFSEERYKAIVKYKTAFYS
FYLPVAAAMYMVGIDSKEEHENAKAILLEMGEYFQIQDDYLDCFGDPALT
GAVGTDIQDNKCSWLVVQCLQRVTPEQRQLLEDNYGRKEPEKVAKVKELY
EAVGMRAAFQQYEESSYRRLQELIEKHSNRLPKEIFLGLAQKIYKRQK

3D structure

• PDB: 1ubw Regulation of product chain length by isoprenyl diphosphate synthases.
• Chain: A
• Resolution: 2.5 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K71 A112 D117 D121 R126 D188 K214 F253 D257 D258
• Catalytic site (residue number reindexed from 1): K52 A93 D98 D102 R107 D169 K195 F234 D238 D239
• Enzyme Commision number: 2.5.1.1: dimethylallyltranstransferase.
  2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	A	D117 D121	D98 D102
BS02	MG	A	D117 D121	D98 D102
BS03	GPP	A	S113 D117 R126 E182 Q185 K214 K280	S94 D98 R107 E163 Q166 K195 K261

Gene Ontology

Molecular Function

• GO:0004161 dimethylallyltranstransferase activity
• GO:0004337 geranyltranstransferase activity
• GO:0004659 prenyltransferase activity
• GO:0016740 transferase activity
• GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups
• GO:0046872 metal ion binding

Biological Process

• GO:0006695 cholesterol biosynthetic process
• GO:0008299 isoprenoid biosynthetic process
• GO:0033384 geranyl diphosphate biosynthetic process
• GO:0045337 farnesyl diphosphate biosynthetic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:1ubw, PDBe:1ubw, PDBj:1ubw
• PDBsum: 1ubw
• PubMed: 8986756
• UniProt: P08836|FPPS_CHICK Farnesyl pyrophosphate synthase (Gene Name=FDPS)