Structure of PDB 1u8b Chain A

Receptor sequence
>1u8bA (length=132) Species: 562 (Escherichia coli) [Search protein sequence]
MKDDQRWQSVLARDPNADGEFVFAVRTTGIFCRPSCRARHALRENVSFYA
NASEALAAGFRPCKRCQPDKANPRQHRLDKITHACRLLEQETPVTLEALA
DQVAMSPFHLHRLFKATTGMTPKAWQQAWRAR
3D structure
PDB1u8b A methylation-dependent electrostatic switch controls DNA repair and transcriptional activation by E. coli ada.
ChainA
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.1.1.63: methylated-DNA--[protein]-cysteine S-methyltransferase.
2.1.1.n11: methylphosphotriester-DNA--[protein]-cysteine S-methyltransferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A V31 T33 T34 I36 R45 A47 L48 N51 R67 K70 V25 T27 T28 I30 R39 A41 L42 N45 R61 K64
BS02 dna A R19 R43 R45 R13 R37 R39
BS03 dna A T101 H117 T127 K129 T95 H111 T121 K123
BS04 dna A R43 S112 F114 H115 R118 R37 S106 F108 H109 R112
BS05 ZN A C38 C42 C69 C72 C32 C36 C63 C66
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0008168 methyltransferase activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006281 DNA repair
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1u8b, PDBe:1u8b, PDBj:1u8b
PDBsum1u8b
PubMed16209950
UniProtP06134|ADA_ECOLI Bifunctional transcriptional activator/DNA repair enzyme Ada (Gene Name=ada)

[Back to BioLiP]