Structure of PDB 1u78 Chain A

Receptor sequence

>1u78A (length=103) Species: 6239 (Caenorhabditis elegans) [Search protein sequence]

PRGSALSDTERAQLDVMKLLNVSLHEMSRKISRSRHCIRVYLKDPVSYGT
SKRAPRRKALSVRDERNVIRAASNSCKTARDIRNELQLSASKRTILNVIK
RSG

3D structure

PDB

1u78 Structural analysis of the bipartite DNA-binding domain of Tc3 transposase bound to transposon DNA

Chain

Resolution

2.69 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	P2 R3 S24 L25 H26 R30 R36 H37 R40 R57 K59 A60 S92 R94 T95	P1 R2 S23 L24 H25 R29 R35 H36 R39 R56 K58 A59 S91 R93 T94
BS02	dna	A	P2 R3 G4 S5 R34 S35 H37 C38 Y49 S52 R54 A55 R57 R58 T79 A80 R81 K93 R94 L97	P1 R2 G3 S4 R33 S34 H36 C37 Y48 S51 R53 A54 R56 R57 T78 A79 R80 K92 R93 L96

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

External links

PDB	RCSB:1u78, PDBe:1u78, PDBj:1u78
PDBsum	1u78
PubMed	15304566
UniProt	P34257\|TC3A_CAEEL Transposable element Tc3 transposase (Gene Name=tc3a)