Structure of PDB 1u4j Chain A

Receptor sequence
>1u4jA (length=118) Species: 132961 (Bungarus caeruleus) [Search protein sequence]
NLKQFKNMIQCAGTRTWTSYIGYGCYCGYGGSGTPVDELDRCCYTHDHCY
NKAANIPGCNPLIKTYSYTCTKPNITCNDTSDSCARFICDCDRTAAICFA
SAPYNINNIMISASTSCQ
3D structure
PDB1u4j Crystal structure of a carbohydrate induced homodimer of phospholipase A(2) from Bungarus caeruleus at 2.1A resolution
ChainA
Resolution2.18 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) Y28 G30 G32 H48 D49 Y52 Y68 D94
Catalytic site (residue number reindexed from 1) Y26 G28 G30 H46 D47 Y50 Y66 D92
Enzyme Commision number 3.1.1.4: phospholipase A2.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 MAN A Y31 G32 D49 Y29 G30 D47
BS02 MAN A L2 L64 L2 L62
Gene Ontology
Molecular Function
GO:0004623 phospholipase A2 activity
GO:0005509 calcium ion binding
GO:0005543 phospholipid binding
GO:0016787 hydrolase activity
GO:0046872 metal ion binding
GO:0047498 calcium-dependent phospholipase A2 activity
GO:0090729 toxin activity
Biological Process
GO:0006644 phospholipid metabolic process
GO:0016042 lipid catabolic process
GO:0035821 modulation of process of another organism
GO:0050482 arachidonate secretion
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1u4j, PDBe:1u4j, PDBj:1u4j
PDBsum1u4j
PubMed15721580
UniProtQ6SLM1|PA2B5_BUNCE Basic phospholipase A2 2 (Fragment)

[Back to BioLiP]