Structure of PDB 1u3h Chain A |
>1u3hA (length=110) Species: 10090 (Mus musculus) [Search protein sequence] |
QVRQSPQSLTVWEGETAILNCSYENSAFDYFPWYQQFPGEGPALLISILS VSDKKEDGRFTIFFNKREKKLSLHIADSQPGDSATYFCAASANSGTYQRF GTGTKLQVVP |
|
PDB | 1u3h Structure of an autoimmune T cell receptor complexed with class II peptide-MHC: insights into MHC bias and antigen specificity |
Chain | A |
Resolution | 2.42 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
A |
N99 G101 |
N93 G95 |
|
|
|
|