Structure of PDB 1u0d Chain A

Receptor sequence
>1u0dA (length=152) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
NTKYNKEFLLYLAGFVDGDGSIIAQIKPNQSHKFKHQLSLTFQVTEKTQR
RWFLDKLVDEIGVGYVRDRGSVSDYILSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LD
3D structure
PDB1u0d Isolation and characterization of new homing endonuclease specificities at individual target site positions.
ChainA
Resolution2.9 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) G19 D20
Catalytic site (residue number reindexed from 1) G18 D19
Enzyme Commision number 3.1.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A D20 G21 S22 I24 Q26 K28 T46 E47 K48 R70 V73 A133 N136 D137 S138 R141 K142 D19 G20 S21 I23 Q25 K27 T45 E46 K47 R69 V72 A132 N135 D136 S137 R140 K141 PDBbind-CN: Kd=2.0nM
BS02 dna A D20 H33 K34 Q38 R68 I81 K116 D137 K139 D19 H32 K33 Q37 R67 I80 K115 D136 K138 PDBbind-CN: Kd=2.0nM
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1u0d, PDBe:1u0d, PDBj:1u0d
PDBsum1u0d
PubMed15313605
UniProtP05725|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]