Structure of PDB 1u0c Chain A

Receptor sequence
>1u0cA (length=152) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
NTKYNKEFLLYLAGFVDGDGSIIAQIKPNQSCKFKHQLSLTFQVTEKTQR
RWFLDKLVDEIGVGYVRDRGSVSDYILSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LD
3D structure
PDB1u0c Isolation and characterization of new homing endonuclease specificities at individual target site positions.
ChainA
Resolution2.5 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) G19 D20
Catalytic site (residue number reindexed from 1) G18 D19
Enzyme Commision number 3.1.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A G19 D20 G21 S22 I24 Q26 Q44 T46 E47 K48 R51 R70 N136 D137 S138 R141 K142 G18 D19 G20 S21 I23 Q25 Q43 T45 E46 K47 R50 R69 N135 D136 S137 R140 K141 PDBbind-CN: Kd=25nM
BS02 dna A S32 C33 Q38 Y66 R68 R70 E80 I81 K139 S31 C32 Q37 Y65 R67 R69 E79 I80 K138 PDBbind-CN: Kd=25nM
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1u0c, PDBe:1u0c, PDBj:1u0c
PDBsum1u0c
PubMed15313605
UniProtP05725|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]