Structure of PDB 1tz8 Chain A

Receptor sequence

>1tz8A (length=115) Species: 9606 (Homo sapiens)

CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLT
TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAA
LLSPYSYSTTAVVTN

3D structure

• PDB: 1tz8 The crystal structure of transthyretin in complex with diethylstilbestrol: a promising template for the design of amyloid inhibitors
• Chain: A
• Resolution: 1.85 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	DES	A	L17 A109 L110 S117	L8 A100 L101 S108

Gene Ontology

Molecular Function

• GO:0005179 hormone activity
• GO:0005515 protein binding
• GO:0042802 identical protein binding
• GO:0070324 thyroid hormone binding

Biological Process

• GO:0006144 purine nucleobase metabolic process
• GO:0007165 signal transduction

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0035578 azurophil granule lumen
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:1tz8, PDBe:1tz8, PDBj:1tz8
• PDBsum: 1tz8
• PubMed: 15469931
• UniProt: P02766|TTHY_HUMAN Transthyretin (Gene Name=TTR)