Structure of PDB 1txg Chain A

Receptor sequence

>1txgA (length=335) Species: 2234 (Archaeoglobus fulgidus)

MIVSILGAGAMGSALSVPLVDNGNEVRIWGTEFDTEILKSISAGREHPRL
GVKLNGVEIFWPEQLEKCLENAEVVLLGVSTDGVLPVMSRILPYLKDQYI
VLISKGLIDFDNSVLTVPEAVWRLKHDLRERTVAITGPAIAREVAKRMPT
TVVFSSPSESSANKMKEIFETEYFGVEVTTDIIGTEITSALKNVYSIAIA
WIRGYESRKNVEMSNAKGVIATRAINEMAELIEILGGDRETAFGLSGFGD
LIATFRGGRNGMLGELLGKGLSIDEAMEELERRGVGVVEGYKTAEKAYRL
SSKINADTKLLDSIYRVLYEGLKVEEVLFELATFK

3D structure

• PDB: 1txg Structural and functional analysis of the gpsA gene product of Archaeoglobus fulgidus: A glycerol-3-phosphate dehydrogenase with an unusual NADP+ preference
• Chain: A
• Resolution: 1.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K192 T254
• Catalytic site (residue number reindexed from 1): K192 T254
• Enzyme Commision number: 1.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GOL	A	R203 K217 F255	R203 K217 F255

Gene Ontology

Molecular Function

• GO:0016491 oxidoreductase activity
• GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
• GO:0051287 NAD binding
• GO:0141153 glycerol-3-phosphate dehydrogenase (NADP+) activity

Biological Process

• GO:0005975 carbohydrate metabolic process
• GO:0006072 glycerol-3-phosphate metabolic process
• GO:0006650 glycerophospholipid metabolic process
• GO:0046167 glycerol-3-phosphate biosynthetic process
• GO:0046168 glycerol-3-phosphate catabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:1txg, PDBe:1txg, PDBj:1txg
• PDBsum: 1txg
• PubMed: 15557260
• UniProt: O29390|GPDA_ARCFU NADP(+)-dependent glycerol-3-phosphate dehydrogenase (Gene Name=gpsA)