Structure of PDB 1tw6 Chain A |
>1tw6A (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] |
GPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFC YGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKGQEYINNIH |
|
PDB | 1tw6 Engineering ML-IAP to produce an extraordinarily potent caspase 9 inhibitor: implications for Smac-dependent anti-apoptotic activity of ML-IAP |
Chain | A |
Resolution | 1.713 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
F81 |
Catalytic site (residue number reindexed from 1) |
F4 |
Enzyme Commision number |
2.3.2.27: RING-type E3 ubiquitin transferase. |
|
|
|