Structure of PDB 1tuv Chain A |
>1tuvA (length=103) Species: 562 (Escherichia coli) [Search protein sequence] |
MLTVIAEIRTRPGQHHRQAVLDQFAKIVPTVLKEEGCHGYAPMVDCAAGV SFQSMAPDSIVMIEQWESIAHLEAHLQTPHMKAYSEAVKGDVLEMNIRIL QPG |
|
PDB | 1tuv Structural and Biochemical Evidence for an Enzymatic Quinone Redox Cycle in Escherichia coli: IDENTIFICATION OF A NOVEL QUINOL MONOOXYGENASE |
Chain | A |
Resolution | 1.7 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
VK3 |
A |
E64 L76 M95 I97 |
E64 L76 M95 I97 |
|
|
|
|