Structure of PDB 1tuk Chain A

Receptor sequence

>1tukA (length=67) Species: 4565 (Triticum aestivum)

ACQASQLAVCASAILSGAKPSGECCGNLRAQQGCFCQYAKDPTYGQYIRS
PHARDTLTSCGLAVPHC

3D structure

• PDB: 1tuk Structure of a liganded type 2 non-specific lipid-transfer protein from wheat and the molecular basis of lipid binding.
• Chain: A
• Resolution: 1.12 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PGM	A	F35 K40 P42 I48 R49 C67	F35 K40 P42 I48 R49 C67

Gene Ontology

Molecular Function

• GO:0008289 lipid binding

Biological Process

• GO:0006869 lipid transport
• GO:0071555 cell wall organization

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:1tuk, PDBe:1tuk, PDBj:1tuk
• PDBsum: 1tuk
• PubMed: 15805594
• UniProt: P82900|NLT2G_WHEAT Non-specific lipid-transfer protein 2G